PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019161P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 351aa    MW: 39489.7 Da    PI: 6.8451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019161P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd llv +++q+G+g+W++++   g+ R+ k+c++rw +yl
   MELO3C019161P1 14 KGPWTPEEDILLVSYIQQHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding45.61.6e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   MELO3C019161P1  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.105965IPR017930Myb domain
SuperFamilySSF466891.11E-3011108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
CDDcd001675.93E-111661No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129418.7566116IPR017930Myb domain
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PfamPF002496.2E-1367112IPR001005SANT/Myb domain
CDDcd001679.80E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDILLVSYIQ QHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKSAF  120
EDNNHSPYTS KSSNHSPTSD FFSKGFFSND SSKRTFDFDS ASSSSAASCF GPNRSSTASS  180
SSSTYYSSAE NISRLLEGWM RSSPKRNDDN ENILIHFHEK QNHDNGDSSM VSIQGLEPKT  240
EEDAGDRLAL GKEIESSMVV SPENLNNDDH NVGGCWEKSS NFDVGKMMKI KKNSFENCEN  300
DNIIKQNRSE NNINNNNNNN NNPPLSFLEK WLLDDTVVQV EEMMSLSPMF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-241411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818780.0LN681878.1 Cucumis melo genomic scaffold, anchoredscaffold00036.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455771.10.0PREDICTED: myb-related protein 306
RefseqXP_008455772.10.0PREDICTED: myb-related protein 306
SwissprotQ9SCU75e-85MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0A0KYR11e-148A0A0A0KYR1_CUCSA; Uncharacterized protein
STRINGPOPTR_0013s06390.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-91myb domain protein 60